Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Parvalbumin beta protein

This E.coli Parvalbumin beta protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin beta

UniProt

P02622

Expression Region

1-113aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alphadolone 3-β-D-Glucuronide
TRC-A575515-0.5MG 0.5 mg

Alphadolone 3-β-D-Glucuronide

Sign In for Pricing
View Details
VPS13A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2617505 3x 1.0 µg

VPS13A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Pank2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6058407 1.0 µg DNA

Pank2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Bcl-2
501254 200 µL

Bcl-2

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) Red Separopore® 4B
20181081-1 1 mL

Goat Anti-Rabbit IgG (H&L) Red Separopore® 4B

Sign In for Pricing
View Details
Human Glutathione S Transferase Pi (GSTp) ELISA Kit
BSKH62049-01 48 Tests

Human Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details