Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Parvalbumin beta protein

This E.coli Parvalbumin beta protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin beta

UniProt

P02622

Expression Region

1-113aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD23B Antibody
OAAB21312-100UL 100 µL

RAD23B Antibody

Sign In for Pricing
View Details
Anti-Gastrokine-2 GKN2 Antibody
A11208 100 µL

Anti-Gastrokine-2 GKN2 Antibody

Sign In for Pricing
View Details
IFN alpha antibody
20-IR86 20 KU

IFN alpha antibody

Sign In for Pricing
View Details
ALMS1L Antibody
abx310239-01 20 µg

ALMS1L Antibody

Sign In for Pricing
View Details
ALMS1L Antibody
abx310239-02 50 µg

ALMS1L Antibody

Sign In for Pricing
View Details
ALMS1L Antibody
abx310239-03 100 µg

ALMS1L Antibody

Sign In for Pricing
View Details