Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Parvalbumin beta protein

This E.coli Parvalbumin beta protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin beta

UniProt

P02622

Expression Region

1-113aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TAB1 Polyclonal Antibody
HS933014-01 50 µg

Anti-TAB1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TAB1 Polyclonal Antibody
HS933014-02 100 µg

Anti-TAB1 Polyclonal Antibody

Sign In for Pricing
View Details
Human UMPS (Sf9) Protein
orb429128-01 2 µg

Human UMPS (Sf9) Protein

Sign In for Pricing
View Details
Human UMPS (Sf9) Protein
orb429128-02 10 µg

Human UMPS (Sf9) Protein

Sign In for Pricing
View Details
Human UMPS (Sf9) Protein
orb429128-03 1 mg

Human UMPS (Sf9) Protein

Sign In for Pricing
View Details
Ubiquitin (Ub) Recombinant, Human discontinued
157248-01 10 µg

Ubiquitin (Ub) Recombinant, Human discontinued

Sign In for Pricing
View Details