Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA1 protein

This Human IFNA1 protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNA1

UniProt

P01562

Expression Region

24-189aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR23 (DCAF11) activation kit by CRISPRa
GA112938 1 Kit

Human WDR23 (DCAF11) activation kit by CRISPRa

Sign In for Pricing
View Details
Snx12 Mouse Gene Knockout Kit (CRISPR)
KN516424 1 Kit

Snx12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCDC51 Mouse Monoclonal Antibody [A8-F4-D1]
M1004-7 100 µL

CCDC51 Mouse Monoclonal Antibody [A8-F4-D1]

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-01 50 μL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-02 100 µL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-03 1 mL

RNF31 Antibody

Sign In for Pricing
View Details