Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FASLG protein

This Human FASLG protein spans the amino acid sequence from region 103-281aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FASLG

UniProt

P48023

Expression Region

103-281aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 103-281aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL1 activation kit by CRISPRa
GA111644 1 Kit

Human KLHL1 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXN2 (NM_002158) Human Over-expression Lysate
LY419494 100 µg

FOXN2 (NM_002158) Human Over-expression Lysate

Sign In for Pricing
View Details
NKAPD1 Human qPCR Primer Pair (NM_018195)
HP225457 200 Reactions

NKAPD1 Human qPCR Primer Pair (NM_018195)

Sign In for Pricing
View Details
MAT2B (NM_013283) Human Recombinant Protein
TP310589L 1 mg

MAT2B (NM_013283) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Cdkn2A Antibody
RC-4955-01 50 μL

Recombinant Cdkn2A Antibody

Sign In for Pricing
View Details
Recombinant Cdkn2A Antibody
RC-4955-02 100 µL

Recombinant Cdkn2A Antibody

Sign In for Pricing
View Details