Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FASLG protein

This Human FASLG protein spans the amino acid sequence from region 103-281aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FASLG

UniProt

P48023

Expression Region

103-281aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 103-281aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR83 (17-30) Goat Polyclonal Antibody
AP31783PU-N 100 µg

GPR83 (17-30) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CPN10 Antibody
RN-14972-01 50 μL

Recombinant CPN10 Antibody

Sign In for Pricing
View Details
Recombinant CPN10 Antibody
RN-14972-02 100 µL

Recombinant CPN10 Antibody

Sign In for Pricing
View Details
Recombinant CPN10 Antibody
RN-14972-03 1 mL

Recombinant CPN10 Antibody

Sign In for Pricing
View Details
TRIM29 Mouse Monoclonal Antibody [Clone ID: OTI5C11]
CF812274 100 µg

TRIM29 Mouse Monoclonal Antibody [Clone ID: OTI5C11]

Sign In for Pricing
View Details
HEPN1 (N-term) Rabbit Polyclonal Antibody
AP52031PU-N 400 µL

HEPN1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details