Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPPK1 protein

This Human EPPK1 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPPK1

UniProt

P58107

Expression Region

1-225aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 1-225aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GrpE Antibody
orb816815 2 mg

GrpE Antibody

Sign In for Pricing
View Details
CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (AP) discontinued
033916-AP 200 µL

CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (AP) discontinued

Sign In for Pricing
View Details
GP Antibody
orb862343 2 mg

GP Antibody

Sign In for Pricing
View Details
Anti-MBD4/MED1 Antibody
MBS1753081-01 0.01 mg

Anti-MBD4/MED1 Antibody

Sign In for Pricing
View Details
Anti-MBD4/MED1 Antibody
MBS1753081-02 0.1 mg (Carrier Free)

Anti-MBD4/MED1 Antibody

Sign In for Pricing
View Details
Anti-MBD4/MED1 Antibody
MBS1753081-03 0.1 mg

Anti-MBD4/MED1 Antibody

Sign In for Pricing
View Details