Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup8 protein

This Mouse Mup8 protein spans the amino acid sequence from region 32-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup8

UniProt

P04938

Expression Region

32-181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Permanganate
RE2338 1 Each

Potassium Permanganate

Sign In for Pricing
View Details
Angpt1 ORF Vector (Rat) (pORF)
ORF063384 1.0 µg DNA

Angpt1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Sema4d Mouse Pre-designed siRNA Set A
HY-RS16931 1 Set

Sema4d Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Akt1, PH Domain, Serine-Threonine Phosphorylation (Rac PKa, PKBa) (APC)
A1125-04-APC 100 µL

Akt1, PH Domain, Serine-Threonine Phosphorylation (Rac PKa, PKBa) (APC)

Sign In for Pricing
View Details
Recombinant Human IgG Antibody
V3583SAF-100UG 100 µg

Recombinant Human IgG Antibody

Sign In for Pricing
View Details
2- (4-Acetyl-3-fluorobenzenesulfonyl) acetic acid
LCC31752-01 50 mg

2- (4-Acetyl-3-fluorobenzenesulfonyl) acetic acid

Sign In for Pricing
View Details