Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EML2 protein

This Human EML2 protein spans the amino acid sequence from region 1-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EML2

UniProt

O95834

Expression Region

1-418aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 1-418aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5730508B09Rik Recombinant Protein (Mouse)
RP112508 100 µg

5730508B09Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Human FYB1 Protein
E30P00901B 50 µg

Recombinant Human FYB1 Protein

Sign In for Pricing
View Details
2- (Chloromethyl) -4- (2,6-difluorophenyl) -1,3-thiazole
TDC92410-01 50 mg

2- (Chloromethyl) -4- (2,6-difluorophenyl) -1,3-thiazole

Sign In for Pricing
View Details
2- (Chloromethyl) -4- (2,6-difluorophenyl) -1,3-thiazole
TDC92410-02 0.5 g

2- (Chloromethyl) -4- (2,6-difluorophenyl) -1,3-thiazole

Sign In for Pricing
View Details
Rabbit Polyclonal PMVK/phosphomevalonate kinase Antibody [DyLight 350]
NBP3-00339UV 0.1 mL

Rabbit Polyclonal PMVK/phosphomevalonate kinase Antibody [DyLight 350]

Sign In for Pricing
View Details
SNAPC4 Protein Vector (Human) (pPM-C-HA)
44508021 500 ng

SNAPC4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details