Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EML2 protein

This Human EML2 protein spans the amino acid sequence from region 1-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EML2

UniProt

O95834

Expression Region

1-418aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 1-418aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA Monoclonal Antibody
AB100220 100 µL

PCNA Monoclonal Antibody

Sign In for Pricing
View Details
NPY2R Rabbit Polyclonal Antibody (Cy5.5)
orb1052240 100 µL

NPY2R Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Mouse Monoclonal Ghrelin/Obestatin Antibody (45) [Alexa Fluor 700]
NBP1-47183AF700 0.1 mL

Mouse Monoclonal Ghrelin/Obestatin Antibody (45) [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)
MBS9423226-01 0.01 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)
MBS9423226-02 0.05 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)
MBS9423226-03 0.1 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C protein (TNFRSF13C)

Sign In for Pricing
View Details