Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human gp120 protein

This Human gp120 recombinant protein spans the amino acid sequence from region 33-511aa. The calculated molecular weight for this env protein is 69.7 kDa. This env protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of env, which enables a simple process of detecting and purifying the env recombinant protein in the following steps.

Product Specifications

Product Name Alternative

Envelope glycoprotein gp160; Env polyprotein

UniProt

P04578

Expression Region

33-511aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

Field of Research

Apoptotic, Cancer, Epigenetics, Infectious Diseases, Neuroscience, Non-Animal, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.7 kDa

Storage Conditions

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Copine-1 (CPNE1) ELISA Kit
MBS7247102-01 48 Well

Porcine Copine-1 (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Porcine Copine-1 (CPNE1) ELISA Kit
MBS7247102-02 96 Well

Porcine Copine-1 (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Porcine Copine-1 (CPNE1) ELISA Kit
MBS7247102-03 5x 96 Well

Porcine Copine-1 (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Porcine Copine-1 (CPNE1) ELISA Kit
MBS7247102-04 10x 96 Well

Porcine Copine-1 (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Phospho-TH (Ser31) Rabbit Polyclonal Antibody (BF750)
orb2429511 100 µL

Phospho-TH (Ser31) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii tatB Protein (aa 1-142)
VAng-Yyj5364-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Vanbaalenii tatB Protein (aa 1-142)

Sign In for Pricing
View Details