Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hbb-b2 protein

This Mouse Hbb-b2 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

UniProt

P02089

Expression Region

2-147aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal IL-23 Antibody (brazikumab) [Janelia Fluor 635]
NBP3-28743JF635 0.1 mL

Human Monoclonal IL-23 Antibody (brazikumab) [Janelia Fluor 635]

Sign In for Pricing
View Details
FAAP100 siRNA (Human)
CRJ2820-01 15 nmol

FAAP100 siRNA (Human)

Sign In for Pricing
View Details
FAAP100 siRNA (Human)
CRJ2820-02 30 nmol

FAAP100 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Uncharacterized protein Rv0628c/MT0656 (Rv0628c, MT0656)
MBS1185875 Inquire

Recombinant Uncharacterized protein Rv0628c/MT0656 (Rv0628c, MT0656)

Sign In for Pricing
View Details
Dnajc6 Mouse qPCR Primer Pair (NM_198412)
MP203869 200 Reactions

Dnajc6 Mouse qPCR Primer Pair (NM_198412)

Sign In for Pricing
View Details
Goat Transforming Growth Factor Beta 2 (TGFb2) Protein
abx655296-01 100 µg

Goat Transforming Growth Factor Beta 2 (TGFb2) Protein

Sign In for Pricing
View Details