Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hbb-b2 protein

This Mouse Hbb-b2 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

UniProt

P02089

Expression Region

2-147aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBV17 3'UTR GFP Stable Cell Line
TU076432 1.0 mL

TRBV17 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Discs, Large Homolog 4 (DLG4) ELISA Kit
orb1736593-01 48 Tests

Human Discs, Large Homolog 4 (DLG4) ELISA Kit

Sign In for Pricing
View Details
Human Discs, Large Homolog 4 (DLG4) ELISA Kit
orb1736593-02 96 Tests

Human Discs, Large Homolog 4 (DLG4) ELISA Kit

Sign In for Pricing
View Details
Anti-Staphylococcus aureus entA/SEA Polyclonal Antibody
JN033014-01 50 µg

Anti-Staphylococcus aureus entA/SEA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Staphylococcus aureus entA/SEA Polyclonal Antibody
JN033014-02 100 µg

Anti-Staphylococcus aureus entA/SEA Polyclonal Antibody

Sign In for Pricing
View Details
Tollip (CT) (Toll interacting protein) (MaxLight 550) discontinued
T8063-52C-ML550 100 µL

Tollip (CT) (Toll interacting protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details