Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF5 protein

This Human EIF5 protein spans the amino acid sequence from region 1-431aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EIF5

UniProt

P55010

Expression Region

1-431aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-431aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT3A / CBP Rabbit Polyclonal Antibody (BF750)
orb1574378 100 µL

KAT3A / CBP Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
UBP31 Polyclonal Antibody
MBS8530825-01 0.1 mg

UBP31 Polyclonal Antibody

Sign In for Pricing
View Details
UBP31 Polyclonal Antibody
MBS8530825-02 0.1 mL (AF635)

UBP31 Polyclonal Antibody

Sign In for Pricing
View Details
UBP31 Polyclonal Antibody
MBS8530825-03 0.1 mL (AF610)

UBP31 Polyclonal Antibody

Sign In for Pricing
View Details
UBP31 Polyclonal Antibody
MBS8530825-04 0.1 mL (AF405S)

UBP31 Polyclonal Antibody

Sign In for Pricing
View Details
UBP31 Polyclonal Antibody
MBS8530825-05 0.1 mL (AF405L)

UBP31 Polyclonal Antibody

Sign In for Pricing
View Details