Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli lptA protein

This E. coli lptA protein spans the amino acid sequence from region 28-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LptA

UniProt

P0ADV1

Expression Region

28-185aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prolactin Receptor, PRLR ELISA Kit
BPE057-01 96 Tests

Human Prolactin Receptor, PRLR ELISA Kit

Sign In for Pricing
View Details
Human Prolactin Receptor, PRLR ELISA Kit
BPE057-02 5x 96 Tests

Human Prolactin Receptor, PRLR ELISA Kit

Sign In for Pricing
View Details
Human Prolactin Receptor, PRLR ELISA Kit
BPE057-03 15 x 96 Tests

Human Prolactin Receptor, PRLR ELISA Kit

Sign In for Pricing
View Details
Lentiviral human IQGAP1 sgRNA gene knockout kit - Lentiviral human IQGAP1 sgRNA gene knockout kit (plasmid)
GTR15370052 1 Vial

Lentiviral human IQGAP1 sgRNA gene knockout kit - Lentiviral human IQGAP1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
LONP2 siRNA (Human)
orb1855069-01 15 nmol

LONP2 siRNA (Human)

Sign In for Pricing
View Details
LONP2 siRNA (Human)
orb1855069-02 30 nmol

LONP2 siRNA (Human)

Sign In for Pricing
View Details