Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ptxA protein

This E.coli ptxA protein spans the amino acid sequence from region 35-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PtxA

UniProt

P04977

Expression Region

35-269aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf153 Protein Vector (Human) (pPM-C-His)
PV066992 500 ng

C9orf153 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ASFV DP63R Recombinant Protein (N-His)
VK628032-01 50 µg

ASFV DP63R Recombinant Protein (N-His)

Sign In for Pricing
View Details
ASFV DP63R Recombinant Protein (N-His)
VK628032-02 100 µg

ASFV DP63R Recombinant Protein (N-His)

Sign In for Pricing
View Details
ASFV DP63R Recombinant Protein (N-His)
VK628032-03 1 mg

ASFV DP63R Recombinant Protein (N-His)

Sign In for Pricing
View Details
Kallikrein 5 Antibody Blocking peptide
orb1448056 500 µg

Kallikrein 5 Antibody Blocking peptide

Sign In for Pricing
View Details
G3BP/G3BP1 Rabbit Polyclonal Antibody (Cy3)
orb2596766 100 µg

G3BP/G3BP1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details