Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLK1 protein

This Human DLK1 protein spans the amino acid sequence from region 24-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLK1

UniProt

P80370

Expression Region

24-303aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 24-303aa and His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block D, 15mm test tubes, 24 wells in block for ThermoMix 500
tmb-d 1 Unit

Block D, 15mm test tubes, 24 wells in block for ThermoMix 500

Sign In for Pricing
View Details
TMEM33 Protein Vector (Human) (pPM-C-HA)
47041021 500 ng

TMEM33 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1328955-01 0.02 mg (E-Coli)

Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1328955-02 0.02 mg (Yeast)

Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1328955-03 0.1 mg (E-Coli)

Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1328955-04 0.1 mg (Yeast)

Recombinant Salinibacter ruber UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details