Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli BALF5 protein

This E.coli BALF5 protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BALF5

UniProt

P03198

Expression Region

1-210aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 ELISA Kit (Human)
OKEH01350-96W 96 Well

CDK2 ELISA Kit (Human)

Sign In for Pricing
View Details
GNPNAT1 Antibody Blocking peptide
orb1448502 500 µg

GNPNAT1 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Monoclonal p57 Kip2 Antibody (KIP2/7083R) [Janelia Fluor 646]
NBP3-14222JF646 0.1 mL

Rabbit Monoclonal p57 Kip2 Antibody (KIP2/7083R) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human Glycoprotein V, Platelet (GP5) ELISA Kit
BSKH62038-01 48 Tests

Human Glycoprotein V, Platelet (GP5) ELISA Kit

Sign In for Pricing
View Details
Human Glycoprotein V, Platelet (GP5) ELISA Kit
BSKH62038-02 96 Tests

Human Glycoprotein V, Platelet (GP5) ELISA Kit

Sign In for Pricing
View Details
GSK3A Antibody : Biotin (OAAF01317-Biotin)
OAAF01317-100UG-Biotin 100 µg

GSK3A Antibody : Biotin (OAAF01317-Biotin)

Sign In for Pricing
View Details