Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli BALF5 protein

This E.coli BALF5 protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BALF5

UniProt

P03198

Expression Region

1-210aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031011 96 Tests

Multiplex Assay Kit for Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Rabbit Polyclonal ROBO1 Antibody
NBP2-68981-25ul 25 µL

Rabbit Polyclonal ROBO1 Antibody

Sign In for Pricing
View Details
HSF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-63270R-BF555 100 µL

HSF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
WDSOF1 Blocking Peptide
33R-10013 0.1 mg

WDSOF1 Blocking Peptide

Sign In for Pricing
View Details
ALS (IGFALS) (NM_004970) Human Over-expression Lysate
LH18857V 100 µg

ALS (IGFALS) (NM_004970) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 750) discontinued
253677-ML750 100 µL

ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 750) discontinued

Sign In for Pricing
View Details