Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse H2-K1 protein

This Mouse H2-K1 protein spans the amino acid sequence from region 22-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2-K1

UniProt

P01902

Expression Region

22-305aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti p53 (pSer33)
pAP11097 100 µL

Rabbit anti p53 (pSer33)

Sign In for Pricing
View Details
Human NAA38 shRNA Plasmid
abx963437-01 150 µg

Human NAA38 shRNA Plasmid

Sign In for Pricing
View Details
Human NAA38 shRNA Plasmid
abx963437-02 300 µg

Human NAA38 shRNA Plasmid

Sign In for Pricing
View Details
Nola1 (BC021873) Mouse Tagged Lenti ORF Clone
MR202402L4 10 µg

Nola1 (BC021873) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
King B Agar 10 x 90 mm Petri
TMB_KNGB_P90_10 10 x 90 mm Petri

King B Agar 10 x 90 mm Petri

Sign In for Pricing
View Details
Rac-4-Ethyl-3-[ (2R,3R) -3-phenyloxolan-2-yl]-4,5-dihydro-1H-1,2,4-triazol-5-one
JHD91431-01 50 mg

Rac-4-Ethyl-3-[ (2R,3R) -3-phenyloxolan-2-yl]-4,5-dihydro-1H-1,2,4-triazol-5-one

Sign In for Pricing
View Details