Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dcn protein

This Mouse Dcn protein spans the amino acid sequence from region 35-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dcn

UniProt

P28654

Expression Region

35-354aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 35-354aa and His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD18 Recombinant Protein (Human)
RP048832 100 µg

BTBD18 Recombinant Protein (Human)

Sign In for Pricing
View Details
Glp2r ORF Vector (Rat) (pORF)
21615016 1.0 µg DNA

Glp2r ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LANCL2 293 Cell Lysate
406281 0.1 mg

LANCL2 293 Cell Lysate

Sign In for Pricing
View Details
LONP2 Antibody
MBS9216600-01 0.1 mL

LONP2 Antibody

Sign In for Pricing
View Details
LONP2 Antibody
MBS9216600-02 5x 0.1 mL

LONP2 Antibody

Sign In for Pricing
View Details
Adenosine-5-Diphosphate Disodium Salt
A8290-01 500 mg

Adenosine-5-Diphosphate Disodium Salt

Sign In for Pricing
View Details