Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli cyp125 protein

This E.coli cyp125 protein spans the amino acid sequence from region 1-433aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyp125

UniProt

P9WPP1

Expression Region

1-433aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-KIR3DL1 antibody
SL10758R-01 50 µL

Rabbit Anti-KIR3DL1 antibody

Sign In for Pricing
View Details
Rabbit Anti-KIR3DL1 antibody
SL10758R-02 100 µL

Rabbit Anti-KIR3DL1 antibody

Sign In for Pricing
View Details
Mouse mmu-miR-6769b-5p miRNA Antagomir
abx889441-01 10 nmol

Mouse mmu-miR-6769b-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-6769b-5p miRNA Antagomir
abx889441-02 20 nmol

Mouse mmu-miR-6769b-5p miRNA Antagomir

Sign In for Pricing
View Details
RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39039066 1.0 µg DNA

RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NF1L5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1420405 3x 1.0 µg

NF1L5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details