Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAOA protein

This Human DAOA protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAOA

UniProt

P59103

Expression Region

1-153aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-153aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TNS4 Antibody (9H535)
TMAB-13658-01 25 µL

Anti-TNS4 Antibody (9H535)

Sign In for Pricing
View Details
Anti-TNS4 Antibody (9H535)
TMAB-13658-02 50 μL

Anti-TNS4 Antibody (9H535)

Sign In for Pricing
View Details
Anti-TNS4 Antibody (9H535)
TMAB-13658-03 100 µL

Anti-TNS4 Antibody (9H535)

Sign In for Pricing
View Details
Estrogen Receptor 1 (ESR1) Mouse Monoclonal Antibody [Clone ID: LBI3G2]
AMM17677V 100 µL

Estrogen Receptor 1 (ESR1) Mouse Monoclonal Antibody [Clone ID: LBI3G2]

Sign In for Pricing
View Details
RGD1303003 ORF Vector (Rat) (pORF)
ORF074742 1.0 µg DNA

RGD1303003 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
AP2B1 Protein Vector (Mouse) (pPM-C-HA)
12108025 500 ng

AP2B1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details