Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAOA protein

This Human DAOA protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAOA

UniProt

P59103

Expression Region

1-153aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-153aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine MCP-2 ELISA Kit
EBM0254 96 Tests

Bovine MCP-2 ELISA Kit

Sign In for Pricing
View Details
CDC2L1 (CDK11B) (NM_033489) Human Tagged Lenti ORF Clone
RC216575L4 10 µg

CDC2L1 (CDK11B) (NM_033489) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PON1 Antibody
E91320 100 µg

PON1 Antibody

Sign In for Pricing
View Details
RFPL3 Antibody
GWB-MV050E 50 µg

RFPL3 Antibody

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter pseudethanolicus Adenylosuccinate synthetase (purA)
MBS1198626-01 0.02 mg (E-Coli)

Recombinant Thermoanaerobacter pseudethanolicus Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter pseudethanolicus Adenylosuccinate synthetase (purA)
MBS1198626-02 0.02 mg (Yeast)

Recombinant Thermoanaerobacter pseudethanolicus Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details