Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ldh1 protein

This E.coli ldh1 protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ldh1

UniProt

P56512

Expression Region

1-320aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr522 (NM_146952) Mouse Tagged Lenti ORF Clone
MR213727L4 10 µg

Olfr522 (NM_146952) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LINC00400 AAV Vector (Human) (CMV)
26729101 1 µg

LINC00400 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-mouse CD34
GT03505 100 µg

PerCP/Cyanine5.5 anti-mouse CD34

Sign In for Pricing
View Details
Easy Amp Real-time Fluorescence Isothermal Detection System
EQ009 1 Each

Easy Amp Real-time Fluorescence Isothermal Detection System

Sign In for Pricing
View Details
OSBPL3 Antibody - N-terminal region
ARP45649_P050-25UL 25 µL

OSBPL3 Antibody - N-terminal region

Sign In for Pricing
View Details
ADAMTS9 (NM_182920) Human Over-expression Lysate
LC405309 20 µg

ADAMTS9 (NM_182920) Human Over-expression Lysate

Sign In for Pricing
View Details