Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ldh1 protein

This E.coli ldh1 protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ldh1

UniProt

P56512

Expression Region

1-320aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
MBS2611889-01 48 Well

Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
MBS2611889-02 96 Well

Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
MBS2611889-03 5x 96 Well

Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
MBS2611889-04 10x 96 Well

Rabbit mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
HERC5 Antibody Blocking Peptide
orb1511583 500 µg

HERC5 Antibody Blocking Peptide

Sign In for Pricing
View Details
Ankrd52 Mouse shRNA Lentiviral Particle (Locus ID 237615)
TL507198V 500 µL Each

Ankrd52 Mouse shRNA Lentiviral Particle (Locus ID 237615)

Sign In for Pricing
View Details