Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ldh1 protein

This E.coli ldh1 protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ldh1

UniProt

P56512

Expression Region

1-320aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psoriasin (S100A7) (NM_002963) Human Over-expression Lysate
LC418993 20 µg

Psoriasin (S100A7) (NM_002963) Human Over-expression Lysate

Sign In for Pricing
View Details
Propylene glycol monocaprate
MBS5783686 Inquire

Propylene glycol monocaprate

Sign In for Pricing
View Details
2- (3-Isopropylphenyl) pyridine
OR94219 250 mg

2- (3-Isopropylphenyl) pyridine

Sign In for Pricing
View Details
Rat Monoclonal M-CSF R/CD115 Antibody (12-3A3-1B10) [DyLight 488]
NBP1-43362G 0.1 mL

Rat Monoclonal M-CSF R/CD115 Antibody (12-3A3-1B10) [DyLight 488]

Sign In for Pricing
View Details
CFP, ID (CFP, PFC, Properdin, Complement factor P) (APC) discontinued
033814-APC 200 µL

CFP, ID (CFP, PFC, Properdin, Complement factor P) (APC) discontinued

Sign In for Pricing
View Details
Hsa-miR-6511b-3p miRNA Mimic
orb1876730-01 5 nmol

Hsa-miR-6511b-3p miRNA Mimic

Sign In for Pricing
View Details