Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CX3CL1 protein

This Human CX3CL1 protein spans the amino acid sequence from region 25-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CX3CL1

UniProt

P78423

Expression Region

25-100aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Chemokine domain of His-SUMO-tag and expression region is 25-100aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-369-5p miRNA Inhibitor
CIH0216-01 10 nmol

Hsa-miR-369-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-369-5p miRNA Inhibitor
CIH0216-02 20 nmol

Hsa-miR-369-5p miRNA Inhibitor

Sign In for Pricing
View Details
DDX3 Rabbit Polyclonal Antibody (Biotin)
orb1602480 100 µL

DDX3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag
058317-01 10 µg

Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag
058317-02 50 µg

Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag
058317-03 100 µg

Adiponectin Receptor 2 (ADIPOR2), Recombinant, Rat, His-Tag, SUMO-Tag

Sign In for Pricing
View Details