Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dio3 protein

This Rat Dio3 protein spans the amino acid sequence from region 63-304aa (170:U→missing) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dio3

UniProt

P49897

Expression Region

63-304aa (170:U→missing)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZNF641 antibody
STJ116648 100 µl

Anti-ZNF641 antibody

Sign In for Pricing
View Details
HYAL1 (NM_007312) Human Over-expression Lysate
LH18331V 100 µg

HYAL1 (NM_007312) Human Over-expression Lysate

Sign In for Pricing
View Details
Neomycin ELISA Kit
DEIA043 96T

Neomycin ELISA Kit

Sign In for Pricing
View Details
Lentiviral human KRTAP4-1 shRNA (UAS) - Lentiviral human KRTAP4-1 shRNA (UAS) (25)
GTR15343304 1 Vial

Lentiviral human KRTAP4-1 shRNA (UAS) - Lentiviral human KRTAP4-1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Human IA-2/PTPRN Protein, MAT Tag
E40KMH597 20 µg

Recombinant Human IA-2/PTPRN Protein, MAT Tag

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Mouse mAb, PE-Cy5.5 conjugated
orb2889454 100 µL

Histone H3 (mono methyl K79) Mouse mAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details