Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ctss protein

This Mouse ctss protein spans the amino acid sequence from region 123-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ctss

UniProt

O70370

Expression Region

123-340aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 123-340aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC21 Human shRNA Plasmid Kit (Locus ID 134218)
TL315212 1 Kit

DNAJC21 Human shRNA Plasmid Kit (Locus ID 134218)

Sign In for Pricing
View Details
Rat Visinin Like Protein 1 ELISA Kit
MBS076877-01 48 Well

Rat Visinin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Visinin Like Protein 1 ELISA Kit
MBS076877-02 96 Well

Rat Visinin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Visinin Like Protein 1 ELISA Kit
MBS076877-03 5x 96 Well

Rat Visinin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Visinin Like Protein 1 ELISA Kit
MBS076877-04 10x 96 Well

Rat Visinin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
ERRFI1 Rabbit Polyclonal Antibody
orb1097058-01 50 μL

ERRFI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details