Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ctsk protein

This Rat Ctsk protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ctsk

UniProt

O35186

Expression Region

115-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 115-329aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF647 conjugate, 0.1mg/mL
BNC471960-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833F-01 25 µg

PerCP Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PerCP Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833F-02 100 µg

PerCP Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
FITC Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UC-01 25 µg

FITC Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
FITC Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UC-02 100 µg

FITC Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
WNT2 Polyclonal Antibody
E-AB-17610-01 20 µL

WNT2 Polyclonal Antibody

Sign In for Pricing
View Details