Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli CTSK protein

This E.coli CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSK

UniProt

P61276

Expression Region

115-329aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 115-329aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptger2 (NM_031088) Rat Untagged Clone
RN212216 10 µg

Ptger2 (NM_031088) Rat Untagged Clone

Sign In for Pricing
View Details
WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (FITC)
135346-FITC 100 µL

WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (FITC)

Sign In for Pricing
View Details
Mmu-miR-6903-3p miRNA Antagomir
orb1912449-01 10 nmol

Mmu-miR-6903-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-6903-3p miRNA Antagomir
orb1912449-02 20 nmol

Mmu-miR-6903-3p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)
AP75694-01 10 µg

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Sign In for Pricing
View Details
Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)
AP75694-02 50 µg

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Sign In for Pricing
View Details