Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli CTSK protein

This E.coli CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSK

UniProt

P61276

Expression Region

115-329aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 115-329aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSLNL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1349906 1.0 µg DNA

MSLNL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) (MaxLight 550)
MBS6394098-01 0.1 mL

SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) (MaxLight 550)

Sign In for Pricing
View Details
SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) (MaxLight 550)
MBS6394098-02 5x 0.1 mL

SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) (MaxLight 550)

Sign In for Pricing
View Details
DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (MaxLight 750) discontinued
125721-ML750 100 µL

DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FAM177A1
CSB-CL847607HU 10 μg Plasmid + 200 μL Glycerol

FAM177A1

Sign In for Pricing
View Details
APOH Antibody
orb1562287-01 50 µL

APOH Antibody

Sign In for Pricing
View Details