Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli CTSK protein

This E.coli CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSK

UniProt

P61276

Expression Region

115-329aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 115-329aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA6 (Homeobox Protein Hox-A6, Homeobox Protein Hox-1B, HOX1B)
128014 100 µg

HOXA6 (Homeobox Protein Hox-A6, Homeobox Protein Hox-1B, HOX1B)

Sign In for Pricing
View Details
FX Antibody
E38PA4300 100 µL

FX Antibody

Sign In for Pricing
View Details
Ethylene Terephthalate Cyclic Heptamer-d28
HY-W738902 1 Each

Ethylene Terephthalate Cyclic Heptamer-d28

Sign In for Pricing
View Details
AKAP14 Rabbit Polyclonal Antibody (HRP)
orb526296 100 µL

AKAP14 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TAF13 (Biotin)
578326-01 50 µg

TAF13 (Biotin)

Sign In for Pricing
View Details
TAF13 (Biotin)
578326-02 100 µg

TAF13 (Biotin)

Sign In for Pricing
View Details