Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTAG2 protein

This Human CTAG2 protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTAG2

UniProt

O75638

Expression Region

1-210aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-210aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMEZ Protein Vector (Mouse) (pPM-C-HA)
PV189492 500 ng

HOMEZ Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NAMPTL Protein Vector (Human) (pPM-C-His)
PV103525 500 ng

NAMPTL Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Mouse FLT3L protein (His tag)
PDEM100068-01 20 µg

Recombinant Mouse FLT3L protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FLT3L protein (His tag)
PDEM100068-02 100 µg

Recombinant Mouse FLT3L protein (His tag)

Sign In for Pricing
View Details
N-Methyl-N- (3-chloropropyl) homoveratrylamine Hydrochloride
CS-T-82756 1 Each

N-Methyl-N- (3-chloropropyl) homoveratrylamine Hydrochloride

Sign In for Pricing
View Details
WFDC2 Human
OM306559-01 2 µg

WFDC2 Human

Sign In for Pricing
View Details