Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli prgI protein

This E.coli prgI protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrgI

UniProt

P41784

Expression Region

1-80aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1C Blocking Peptide
MBS822790-01 1 mg

POLR1C Blocking Peptide

Sign In for Pricing
View Details
POLR1C Blocking Peptide
MBS822790-02 5 mg

POLR1C Blocking Peptide

Sign In for Pricing
View Details
POLR1C Blocking Peptide
MBS822790-03 5x 5 mg

POLR1C Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human 14-3-3 protein sigma
MBS967183-01 0.02 mg (E-Coli)

Recombinant Human 14-3-3 protein sigma

Sign In for Pricing
View Details
Recombinant Human 14-3-3 protein sigma
MBS967183-02 0.1 mg (E-Coli)

Recombinant Human 14-3-3 protein sigma

Sign In for Pricing
View Details
Recombinant Human 14-3-3 protein sigma
MBS967183-03 1 mg (E-Coli)

Recombinant Human 14-3-3 protein sigma

Sign In for Pricing
View Details