What is the catalog number for E.coli Car b 1 isoform 2 protein?

The catalog number for E.coli Car b 1 isoform 2 protein is orb244698.

What sizes are available for E.coli Car b 1 isoform 2 protein?

E.coli Car b 1 isoform 2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli Car b 1 isoform 2 protein come in?

E.coli Car b 1 isoform 2 protein is available in 3 different pack sizes.

Is E.coli Car b 1 isoform 2 protein in stock?

E.coli Car b 1 isoform 2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli Car b 1 isoform 2 protein

This E.coli Car b 1 isoform 2 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Car b 1 isoform 2, Allergen Car b I, allergen Car b 1

UniProt

P38950

Expression Region

2-160aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN