Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CS protein

This Human CS protein spans the amino acid sequence from region 28-464aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CS

UniProt

O75390

Expression Region

28-464aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 28-466aa of His-tag and expression region is 28-464aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Cellular retinoic acid binding protein 1 (CRABP1) ELISA kit
GTR10476464 96 Well

Sheep Cellular retinoic acid binding protein 1 (CRABP1) ELISA kit

Sign In for Pricing
View Details
Human Meiosis expressed gene 1 protein homolog, MEIG1 ELISA KIT
ELI-46003h 96 Tests

Human Meiosis expressed gene 1 protein homolog, MEIG1 ELISA KIT

Sign In for Pricing
View Details
MGAT4C (NM_013244) Human Untagged Clone
SC322762 10 µg

MGAT4C (NM_013244) Human Untagged Clone

Sign In for Pricing
View Details
Magic™ Membrane Protein Mouse Pip4p1 (Phosphatidylinositol-4,5-bisphosphate 4-phosphatase 1) Expressed in vitro E.coli expression system, Full Length
MPX1563K Each

Magic™ Membrane Protein Mouse Pip4p1 (Phosphatidylinositol-4,5-bisphosphate 4-phosphatase 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
SELPLG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2115706 1.0 µg DNA

SELPLG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
BC080695 Double Nickase Plasmid (m)
sc-435985-NIC 20 µg

BC080695 Double Nickase Plasmid (m)

Sign In for Pricing
View Details