Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRYAB protein

This Human CRYAB protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRYAB

UniProt

P02511

Expression Region

1-175aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-175aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-525-5p miRNA Agomir
orb1921288-01 5 nmol

Hsa-miR-525-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-525-5p miRNA Agomir
orb1921288-02 10 nmol

Hsa-miR-525-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-525-5p miRNA Agomir
orb1921288-03 20 nmol

Hsa-miR-525-5p miRNA Agomir

Sign In for Pricing
View Details
FACL4/ACSL4 Mouse Monoclonal Antibody (Fluoro550)
orb3084363 100 µg

FACL4/ACSL4 Mouse Monoclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti-SN38 antibody (1G1); Rabbit mAb
MBS1882818-01 0.01 mg

Anti-SN38 antibody (1G1); Rabbit mAb

Sign In for Pricing
View Details
Anti-SN38 antibody (1G1); Rabbit mAb
MBS1882818-02 0.1 mg

Anti-SN38 antibody (1G1); Rabbit mAb

Sign In for Pricing
View Details