Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S protein

This Bovine S protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein

UniProt

P25194

Expression Region

326-540aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bovine coronavirus (strain vaccine) (BCoV) (BCV)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human IgA Antibody
KC-079-01 50 μL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
Anti-Human IgA Antibody
KC-079-02 100 µL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
Anti-Human IgA Antibody
KC-079-03 1 mL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
N-Nitroso Chloroquine
TRC-N132090-100MG 100 mg

N-Nitroso Chloroquine

Sign In for Pricing
View Details
Human C17orf99 activation kit by CRISPRa
GA119185 1 Kit

Human C17orf99 activation kit by CRISPRa

Sign In for Pricing
View Details
N4-Ethyl-2’-deoxycytidine
TRC-E913390-1G 1 g

N4-Ethyl-2’-deoxycytidine

Sign In for Pricing
View Details