Bovine S protein
This Bovine S protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein
UniProt
P25194
Expression Region
326-540aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Bovine coronavirus (strain vaccine) (BCoV) (BCV)
Field of Research
Epigenetics, Infectious Diseases, Non-Animal
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-DEFa5-Mu-01 96 Tests
Mouse Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit
Sign In for Pricing
View Details RD-DEFa5-Mu-02 48 Tests
Mouse Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit
Sign In for Pricing
View Details ![CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: B-E16]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fcf18/imageurl/am31227af-n.webp)
AM31227AF-N 200 µg
CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: B-E16]
Sign In for Pricing
View Details 
![FOXA1 Recombinant Rabbit Monoclonal Antibody [JF10-02]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b0d/imageurl/et1702-89.webp)
ET1702-89 100 µL
FOXA1 Recombinant Rabbit Monoclonal Antibody [JF10-02]
Sign In for Pricing
View Details 