Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S protein

This Bovine S protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein

UniProt

P25194

Expression Region

326-540aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bovine coronavirus (strain vaccine) (BCoV) (BCV)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNIP Recombinant Rabbit Monoclonal Antibody [JM60-35]
ET1705-72 100 µL

TXNIP Recombinant Rabbit Monoclonal Antibody [JM60-35]

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS714727 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS648740 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Factor VIII Antibody
8C0187-AAT 50 µg

Factor VIII Antibody

Sign In for Pricing
View Details
CGRP Antibody (CALCA)
F40344-0.08ML 0.08 mL

CGRP Antibody (CALCA)

Sign In for Pricing
View Details
EEF1G (NM_001404) Human Recombinant Protein
TP319578L 1 mg

EEF1G (NM_001404) Human Recombinant Protein

Sign In for Pricing
View Details