Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli ompA protein

This E.coli ompA protein spans the amino acid sequence from region 23-396aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpA

UniProt

P23732

Expression Region

23-396aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chlamydia trachomatis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Major outer membrane porin, serovar A chain of His-SUMO-tag and expression region is 23-396aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAAPTTRDVAGLEKDPVVNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQSSGFDTANIVPNTALNQAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAKPVLDTTTLNPTIAGKGTVVSSAENELADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-21, Recombinant, Human discontinued
143397-01 2 µg

IL-21, Recombinant, Human discontinued

Sign In for Pricing
View Details
IL-21, Recombinant, Human discontinued
143397-02 10 µg

IL-21, Recombinant, Human discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790
DL87636A-01 100 µL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790
DL87636A-02 500 µL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790
DL87636A-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 790

Sign In for Pricing
View Details
CPN1 (NM_001308) Human Tagged Lenti ORF Clone
RC206606L3 10 µg

CPN1 (NM_001308) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details