Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COX4I1 protein

This Human COX4I1 protein spans the amino acid sequence from region 23-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COX4I1

UniProt

P13073

Expression Region

23-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 23-169aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAMP2 Antibody
MBS7127642-01 0.05 mL

RAMP2 Antibody

Sign In for Pricing
View Details
RAMP2 Antibody
MBS7127642-02 0.1 mL

RAMP2 Antibody

Sign In for Pricing
View Details
RAMP2 Antibody
MBS7127642-03 5x 0.1 mL

RAMP2 Antibody

Sign In for Pricing
View Details
GRX7 Antibody
orb846499 2 mg

GRX7 Antibody

Sign In for Pricing
View Details
Human MMP8 Pre-designed siRNA Set B
SI009682B 1 Each

Human MMP8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PTN Rabbit mAb
MBS9467998-01 0.1 mL

PTN Rabbit mAb

Sign In for Pricing
View Details