What is the catalog number for Human Collagen IV protein?

The catalog number for Human Collagen IV protein is orb244124.

What sizes are available for Human Collagen IV protein?

Human Collagen IV protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human Collagen IV protein come in?

Human Collagen IV protein is available in 3 different pack sizes.

Is Human Collagen IV protein in stock?

Human Collagen IV protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human Collagen IV protein

This Human Collagen IV protein spans the amino acid sequence from region 1427-1668aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Goodpasture antigen

UniProt

Q01955

Expression Region

1427-1668aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 29-1670aa of His-tag and expression region is 1446-1667aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK