Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Collagen IV protein

This Human Collagen IV protein spans the amino acid sequence from region 1427-1668aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Goodpasture antigen

UniProt

Q01955

Expression Region

1427-1668aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 29-1670aa of His-tag and expression region is 1446-1667aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT5M siRNA
abx926493-01 15 nmol

Human NT5M siRNA

Sign In for Pricing
View Details
Human NT5M siRNA
abx926493-02 30 nmol

Human NT5M siRNA

Sign In for Pricing
View Details
Anti-HOXB8 Antibody, Rabbit Polyclonal
MBS8100522-01 0.02 mL

Anti-HOXB8 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-HOXB8 Antibody, Rabbit Polyclonal
MBS8100522-02 0.1 mL

Anti-HOXB8 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-HOXB8 Antibody, Rabbit Polyclonal
MBS8100522-03 5x 0.1 mL

Anti-HOXB8 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Zebrafish IL-17 ELISA Kit
orb1216516-01 1 set (1 x capture antibody)

Zebrafish IL-17 ELISA Kit

Sign In for Pricing
View Details