Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human vpx protein

This Human vpx protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vpx

UniProt

P18099

Expression Region

1-113aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)

Field of Research

Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-113aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gas filter housing,226/Fin,316L,1,40'', TC DN25, Silic, Electr, Mechpo
CHDDQK0140T25SEMY 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Gas filter housing,226/Fin,316L,1,40'', TC DN25, Silic, Electr, Mechpo

Sign In for Pricing
View Details
Anti-Siglec-3/CD33 Antibody (Vadastuximab talirine)
F1485-.1 100 µg

Anti-Siglec-3/CD33 Antibody (Vadastuximab talirine)

Sign In for Pricing
View Details
Human Relaxin, RLN ELISA Kit
MBS163802-01 48 Well

Human Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Human Relaxin, RLN ELISA Kit
MBS163802-02 96 Well

Human Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Human Relaxin, RLN ELISA Kit
MBS163802-03 5x 96 Well

Human Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Human Relaxin, RLN ELISA Kit
MBS163802-04 10x 96 Well

Human Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details