Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mcpt4 protein

This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mcpt4

UniProt

P21812

Expression Region

21-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 21-246aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Omentin-1 ELISA Kit
MBS037914-01 48 Well

Bovine Omentin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Omentin-1 ELISA Kit
MBS037914-02 96 Well

Bovine Omentin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Omentin-1 ELISA Kit
MBS037914-03 5x 96 Well

Bovine Omentin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Omentin-1 ELISA Kit
MBS037914-04 10x 96 Well

Bovine Omentin-1 ELISA Kit

Sign In for Pricing
View Details
LMA2L Rabbit Polyclonal Antibody
JOT-AP03423-01 50ul

LMA2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LMA2L Rabbit Polyclonal Antibody
JOT-AP03423-02 100ul

LMA2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details