Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mcpt4 protein

This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mcpt4

UniProt

P21812

Expression Region

21-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 21-246aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KD-Validated Anti-Ring Finger Protein 40 Rabbit Monoclonal Antibody
AGI1653-100 100 µL

KD-Validated Anti-Ring Finger Protein 40 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SRA1 Protein Lysate
OCOA15861-20UG 20 µg

SRA1 Protein Lysate

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis UPF0756 membrane protein BALH_4179 (BALH_4179)
MBS1054669 Inquire

Recombinant Bacillus thuringiensis UPF0756 membrane protein BALH_4179 (BALH_4179)

Sign In for Pricing
View Details
PIB5PA Polyclonal Antibody
ABP-PAB-31034 50 ug

PIB5PA Polyclonal Antibody

Sign In for Pricing
View Details
Human C5L2/GPR77 MAb (Clone 650918)
MAB10254-100 100 µg

Human C5L2/GPR77 MAb (Clone 650918)

Sign In for Pricing
View Details
Retinoblastoma (Phospho-Ser811) Antibody
E11-0810A 100 µg

Retinoblastoma (Phospho-Ser811) Antibody

Sign In for Pricing
View Details