Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli GM2S-1 protein

This E.coli GM2S-1 protein spans the amino acid sequence from region 22-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GM2S-1

UniProt

P19594

Expression Region

22-158aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 22-158aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Phosphatase 1 beta Recombinant Rabbit mAb
BS46335-01 50 µL

Protein Phosphatase 1 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details
Protein Phosphatase 1 beta Recombinant Rabbit mAb
BS46335-02 100 µL

Protein Phosphatase 1 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details
Anti-Human CD49b/ITGA2 Antibody (SAA0018), PerCP
HB772147-01 1 Each

Anti-Human CD49b/ITGA2 Antibody (SAA0018), PerCP

Sign In for Pricing
View Details
Anti-Human CD49b/ITGA2 Antibody (SAA0018), PerCP
HB772147-02 100 Tests

Anti-Human CD49b/ITGA2 Antibody (SAA0018), PerCP

Sign In for Pricing
View Details
CD300LB (NM_174892) Human Over-expression Lysate
LS124599-100ug 100 µg

CD300LB (NM_174892) Human Over-expression Lysate

Sign In for Pricing
View Details
BAG3 Protein (N-Sumo, Human)
P513416 100 µg

BAG3 Protein (N-Sumo, Human)

Sign In for Pricing
View Details